Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4323826..4324451 | Replicon | chromosome |
Accession | NZ_CP101292 | ||
Organism | Escherichia coli strain 2003-3014 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NMK58_RS22405 | Protein ID | WP_000911330.1 |
Coordinates | 4323826..4324224 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NMK58_RS22410 | Protein ID | WP_000450524.1 |
Coordinates | 4324224..4324451 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK58_RS22385 (4319704) | 4319704..4319904 | + | 201 | WP_000383836.1 | YpfN family protein | - |
NMK58_RS22390 (4320014) | 4320014..4320712 | - | 699 | WP_000679812.1 | esterase | - |
NMK58_RS22395 (4320786) | 4320786..4322801 | - | 2016 | WP_000829332.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NMK58_RS22400 (4322816) | 4322816..4323679 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
NMK58_RS22405 (4323826) | 4323826..4324224 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NMK58_RS22410 (4324224) | 4324224..4324451 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NMK58_RS22415 (4324605) | 4324605..4325318 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NMK58_RS22420 (4325531) | 4325531..4326565 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NMK58_RS22425 (4326582) | 4326582..4327460 | - | 879 | WP_001311023.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NMK58_RS22430 (4327606) | 4327606..4328178 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NMK58_RS22435 (4328178) | 4328178..4328648 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T251817 WP_000911330.1 NZ_CP101292:c4324224-4323826 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|