251815

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3646735..3647570 Replicon chromosome
Accession NZ_CP101292
Organism Escherichia coli strain 2003-3014

Toxin (Protein)


Gene name yeeV Uniprot ID A0A136X5A2
Locus tag NMK58_RS18945 Protein ID WP_000854757.1
Coordinates 3647193..3647570 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NMK58_RS18940 Protein ID WP_001295723.1
Coordinates 3646735..3647103 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK58_RS18900 (3642842) 3642842..3643189 - 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
NMK58_RS18905 (3643186) 3643186..3643590 - 405 WP_000839179.1 transposase -
NMK58_RS18910 (3643670) 3643670..3644020 + 351 Protein_3697 IrmA family protein -
NMK58_RS18915 (3644099) 3644099..3644332 + 234 WP_001119729.1 DUF905 family protein -
NMK58_RS18920 (3644432) 3644432..3645250 + 819 WP_001234620.1 DUF932 domain-containing protein -
NMK58_RS18925 (3645305) 3645305..3645790 + 486 WP_000849582.1 antirestriction protein -
NMK58_RS18930 (3645806) 3645806..3646282 + 477 WP_001186725.1 RadC family protein -
NMK58_RS18935 (3646351) 3646351..3646572 + 222 WP_000692323.1 DUF987 domain-containing protein -
NMK58_RS18940 (3646735) 3646735..3647103 + 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NMK58_RS18945 (3647193) 3647193..3647570 + 378 WP_000854757.1 TA system toxin CbtA family protein Toxin
NMK58_RS18950 (3647567) 3647567..3647716 + 150 Protein_3705 DUF5983 family protein -
NMK58_RS18955 (3647816) 3647816..3647896 + 81 Protein_3706 hypothetical protein -
NMK58_RS18960 (3648712) 3648712..3649083 + 372 WP_001295631.1 IS110 family transposase -
NMK58_RS18965 (3649354) 3649354..3649719 + 366 WP_001282181.1 EutP/PduV family microcompartment system protein -
NMK58_RS18970 (3649820) 3649820..3650149 - 330 WP_000450409.1 DUF496 family protein -
NMK58_RS18975 (3650321) 3650321..3651379 - 1059 WP_001200883.1 FUSC family protein -
NMK58_RS18980 (3651577) 3651577..3652050 - 474 WP_001105384.1 DNA gyrase inhibitor SbmC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14153.18 Da        Isoelectric Point: 7.3249

>T251815 WP_000854757.1 NZ_CP101292:3647193-3647570 [Escherichia coli]
MKTLPDTHVREVSCCPSLVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT251815 WP_001295723.1 NZ_CP101292:3646735-3647103 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A136X5A2

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References