Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3109395..3109921 | Replicon | chromosome |
Accession | NZ_CP101292 | ||
Organism | Escherichia coli strain 2003-3014 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NMK58_RS16185 | Protein ID | WP_000323025.1 |
Coordinates | 3109395..3109682 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NMK58_RS16190 | Protein ID | WP_000534858.1 |
Coordinates | 3109682..3109921 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK58_RS16135 (3104419) | 3104419..3104634 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
NMK58_RS16140 (3104854) | 3104854..3105024 | + | 171 | WP_001405948.1 | putative zinc-binding protein YnfU | - |
NMK58_RS16145 (3105388) | 3105388..3105603 | - | 216 | WP_000066483.1 | cold shock-like protein CspB | - |
NMK58_RS16150 (3105904) | 3105904..3106116 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
NMK58_RS16155 (3106171) | 3106171..3106260 | + | 90 | WP_120795389.1 | hypothetical protein | - |
NMK58_RS16160 (3106538) | 3106538..3107290 | - | 753 | WP_001047133.1 | antitermination protein | - |
NMK58_RS16165 (3107304) | 3107304..3108353 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
NMK58_RS16170 (3108355) | 3108355..3108633 | - | 279 | WP_012304870.1 | hypothetical protein | - |
NMK58_RS16175 (3108700) | 3108700..3108951 | - | 252 | WP_000980994.1 | protein Rem | - |
NMK58_RS16180 (3109168) | 3109168..3109323 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
NMK58_RS16185 (3109395) | 3109395..3109682 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NMK58_RS16190 (3109682) | 3109682..3109921 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NMK58_RS16195 (3109946) | 3109946..3110251 | + | 306 | WP_001326990.1 | protein YdfV | - |
NMK58_RS16200 (3110454) | 3110454..3110786 | + | 333 | WP_001317460.1 | FlxA-like family protein | - |
NMK58_RS16205 (3111223) | 3111223..3111372 | - | 150 | WP_180302674.1 | protein YdfW | - |
NMK58_RS16210 (3111493) | 3111493..3112542 | - | 1050 | Protein_3168 | ISNCY family transposase | - |
NMK58_RS16215 (3112597) | 3112597..3113016 | - | 420 | WP_001151195.1 | DUF977 family protein | - |
NMK58_RS16220 (3113057) | 3113057..3114022 | - | 966 | WP_000054507.1 | hypothetical protein | - |
NMK58_RS16225 (3114003) | 3114003..3114524 | - | 522 | WP_000705349.1 | toxin YdaT family protein | - |
NMK58_RS16230 (3114508) | 3114508..3114735 | - | 228 | WP_000476993.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' / nleD | 3018967..3127955 | 108988 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T251809 WP_000323025.1 NZ_CP101292:c3109682-3109395 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|