Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2881634..2882272 | Replicon | chromosome |
Accession | NZ_CP101292 | ||
Organism | Escherichia coli strain 2003-3014 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NMK58_RS14965 | Protein ID | WP_000813794.1 |
Coordinates | 2881634..2881810 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NMK58_RS14970 | Protein ID | WP_001270286.1 |
Coordinates | 2881856..2882272 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK58_RS14945 (2877253) | 2877253..2878428 | - | 1176 | WP_024017328.1 | BenE family transporter YdcO | - |
NMK58_RS14950 (2878520) | 2878520..2879056 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NMK58_RS14955 (2879129) | 2879129..2881090 | + | 1962 | WP_001341357.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NMK58_RS14960 (2881182) | 2881182..2881412 | - | 231 | WP_000494244.1 | YncJ family protein | - |
NMK58_RS14965 (2881634) | 2881634..2881810 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NMK58_RS14970 (2881856) | 2881856..2882272 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NMK58_RS14975 (2882351) | 2882351..2883756 | + | 1406 | Protein_2924 | PLP-dependent aminotransferase family protein | - |
NMK58_RS14980 (2884001) | 2884001..2885146 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
NMK58_RS14985 (2885164) | 2885164..2886177 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NMK58_RS14990 (2886178) | 2886178..2887119 | + | 942 | WP_001251332.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2876065..2877213 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T251807 WP_000813794.1 NZ_CP101292:2881634-2881810 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT251807 WP_001270286.1 NZ_CP101292:2881856-2882272 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|