Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1305488..1306106 | Replicon | chromosome |
Accession | NZ_CP101292 | ||
Organism | Escherichia coli strain 2003-3014 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NMK58_RS06240 | Protein ID | WP_001291435.1 |
Coordinates | 1305488..1305706 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NMK58_RS06245 | Protein ID | WP_000344800.1 |
Coordinates | 1305732..1306106 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK58_RS06205 (1300778) | 1300778..1301350 | + | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
NMK58_RS06210 (1301381) | 1301381..1301692 | - | 312 | WP_000409911.1 | MGMT family protein | - |
NMK58_RS06220 (1302070) | 1302070..1302423 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NMK58_RS06225 (1302465) | 1302465..1304015 | - | 1551 | WP_001342068.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NMK58_RS06230 (1304179) | 1304179..1304649 | - | 471 | WP_000136192.1 | YlaC family protein | - |
NMK58_RS06235 (1304765) | 1304765..1305316 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NMK58_RS06240 (1305488) | 1305488..1305706 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NMK58_RS06245 (1305732) | 1305732..1306106 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NMK58_RS06250 (1306652) | 1306652..1309801 | - | 3150 | WP_001132475.1 | efflux RND transporter permease AcrB | - |
NMK58_RS06255 (1309824) | 1309824..1311017 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T251801 WP_001291435.1 NZ_CP101292:c1305706-1305488 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT251801 WP_000344800.1 NZ_CP101292:c1306106-1305732 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |