Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1271191..1272028 | Replicon | chromosome |
Accession | NZ_CP101292 | ||
Organism | Escherichia coli strain 2003-3014 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NMK58_RS06070 | Protein ID | WP_000227784.1 |
Coordinates | 1271191..1271733 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NMK58_RS06075 | Protein ID | WP_001297137.1 |
Coordinates | 1271717..1272028 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK58_RS06050 (1266730) | 1266730..1267641 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
NMK58_RS06055 (1267809) | 1267809..1268300 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NMK58_RS06060 (1268428) | 1268428..1269792 | - | 1365 | WP_001000977.1 | MFS transporter | - |
NMK58_RS06065 (1270200) | 1270200..1271135 | + | 936 | WP_001375746.1 | tetratricopeptide repeat protein | - |
NMK58_RS06070 (1271191) | 1271191..1271733 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NMK58_RS06075 (1271717) | 1271717..1272028 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NMK58_RS06080 (1272213) | 1272213..1273103 | - | 891 | WP_000971336.1 | heme o synthase | - |
NMK58_RS06085 (1273115) | 1273115..1273444 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NMK58_RS06090 (1273444) | 1273444..1274058 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NMK58_RS06095 (1274048) | 1274048..1276039 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NMK58_RS06100 (1276061) | 1276061..1277008 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T251800 WP_000227784.1 NZ_CP101292:c1271733-1271191 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|