Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 671410..672242 | Replicon | chromosome |
| Accession | NZ_CP101292 | ||
| Organism | Escherichia coli strain 2003-3014 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | NMK58_RS03210 | Protein ID | WP_000854753.1 |
| Coordinates | 671868..672242 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | V0ULY5 |
| Locus tag | NMK58_RS03205 | Protein ID | WP_001315620.1 |
| Coordinates | 671410..671778 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK58_RS03175 (668246) | 668246..668701 | + | 456 | WP_000581504.1 | IrmA family protein | - |
| NMK58_RS03180 (668780) | 668780..669013 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| NMK58_RS03185 (669113) | 669113..669931 | + | 819 | WP_001234622.1 | DUF932 domain-containing protein | - |
| NMK58_RS03190 (669986) | 669986..670471 | + | 486 | WP_000849588.1 | antirestriction protein | - |
| NMK58_RS03195 (670487) | 670487..670963 | + | 477 | WP_001186774.1 | RadC family protein | - |
| NMK58_RS03200 (671026) | 671026..671247 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NMK58_RS03205 (671410) | 671410..671778 | + | 369 | WP_001315620.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NMK58_RS03210 (671868) | 671868..672242 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| NMK58_RS03215 (672239) | 672239..672727 | + | 489 | WP_000777547.1 | DUF5983 family protein | - |
| NMK58_RS03220 (672739) | 672739..672936 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| NMK58_RS03225 (673021) | 673021..673170 | + | 150 | Protein_624 | restriction endonuclease subunit M | - |
| NMK58_RS03230 (673938) | 673938..674081 | - | 144 | Protein_625 | HNH endonuclease | - |
| NMK58_RS03235 (674218) | 674218..674868 | + | 651 | WP_001037966.1 | HNH endonuclease | - |
| NMK58_RS03240 (674876) | 674876..675856 | - | 981 | WP_000991415.1 | sialate O-acetylesterase | - |
| NMK58_RS03245 (675921) | 675921..677027 | - | 1107 | WP_001341302.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T251797 WP_000854753.1 NZ_CP101292:671868-672242 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0ULY5 |