Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1327827..1328743 | Replicon | chromosome |
Accession | NZ_CP101290 | ||
Organism | Bacillus subtilis strain LjM2 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | NMT99_RS06960 | Protein ID | WP_003244695.1 |
Coordinates | 1327997..1328743 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NMT99_RS06955 | Protein ID | WP_003232646.1 |
Coordinates | 1327827..1327997 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMT99_RS06920 | 1324693..1325019 | + | 327 | WP_069703538.1 | XkdW family protein | - |
NMT99_RS06925 | 1325016..1325180 | + | 165 | WP_014479563.1 | XkdX family protein | - |
NMT99_RS06930 | 1325224..1326063 | + | 840 | WP_029727045.1 | phage-like element PBSX protein XepA | - |
NMT99_RS06935 | 1326116..1326385 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
NMT99_RS06940 | 1326398..1326661 | + | 264 | WP_014479566.1 | phage holin | - |
NMT99_RS06945 | 1326674..1327567 | + | 894 | WP_029727044.1 | N-acetylmuramoyl-L-alanine amidase | - |
NMT99_RS06950 | 1327604..1327741 | - | 138 | WP_119899277.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NMT99_RS06955 | 1327827..1327997 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NMT99_RS06960 | 1327997..1328743 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NMT99_RS06965 | 1328853..1329854 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
NMT99_RS06970 | 1329867..1330484 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NMT99_RS06975 | 1330760..1332076 | - | 1317 | WP_015252262.1 | serine/threonine exchanger | - |
NMT99_RS06980 | 1332465..1333415 | + | 951 | WP_014476561.1 | ring-cleaving dioxygenase | - |
NMT99_RS06985 | 1333524..1333619 | + | 96 | Protein_1312 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T251792 WP_003244695.1 NZ_CP101290:c1328743-1327997 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|