Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 2877390..2877964 | Replicon | chromosome |
| Accession | NZ_CP101283 | ||
| Organism | Phenylobacterium sp. LH3H17 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | M9M90_RS14100 | Protein ID | WP_254833854.1 |
| Coordinates | 2877632..2877964 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | M9M90_RS14095 | Protein ID | WP_254833853.1 |
| Coordinates | 2877390..2877632 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9M90_RS14070 (M9M90_14070) | 2872580..2873923 | - | 1344 | WP_254833848.1 | dicarboxylate/amino acid:cation symporter | - |
| M9M90_RS14075 (M9M90_14075) | 2874031..2874528 | - | 498 | WP_254833849.1 | hypothetical protein | - |
| M9M90_RS14080 (M9M90_14080) | 2874670..2875662 | + | 993 | WP_254833850.1 | ABC transporter ATP-binding protein | - |
| M9M90_RS14085 (M9M90_14085) | 2875666..2876496 | + | 831 | WP_254833851.1 | hypothetical protein | - |
| M9M90_RS14090 (M9M90_14090) | 2876501..2877304 | + | 804 | WP_254833852.1 | ABC-2 family transporter protein | - |
| M9M90_RS14095 (M9M90_14095) | 2877390..2877632 | + | 243 | WP_254833853.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M9M90_RS14100 (M9M90_14100) | 2877632..2877964 | + | 333 | WP_254833854.1 | endoribonuclease MazF | Toxin |
| M9M90_RS14105 (M9M90_14105) | 2877970..2878977 | - | 1008 | WP_254833855.1 | nitronate monooxygenase family protein | - |
| M9M90_RS14110 (M9M90_14110) | 2879116..2880537 | + | 1422 | WP_254833856.1 | methylmalonyl-CoA mutase family protein | - |
| M9M90_RS14115 (M9M90_14115) | 2880534..2882684 | + | 2151 | WP_254833857.1 | methylmalonyl-CoA mutase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12091.12 Da Isoelectric Point: 9.1367
>T251790 WP_254833854.1 NZ_CP101283:2877632-2877964 [Phenylobacterium sp. LH3H17]
VPDYVPDAGHIVWLEFDPQAGHEQAGHRPALVLSAARYNRLRGMMLCCPMTSRIKGYVFEVVASDDPPSVILSDQVKSLD
WRARRAIRKGSVAPAILAEVKAKIAALLQL
VPDYVPDAGHIVWLEFDPQAGHEQAGHRPALVLSAARYNRLRGMMLCCPMTSRIKGYVFEVVASDDPPSVILSDQVKSLD
WRARRAIRKGSVAPAILAEVKAKIAALLQL
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|