Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 142400..143043 | Replicon | plasmid pEC21Z014-165K |
Accession | NZ_CP101275 | ||
Organism | Escherichia coli strain EC21Z-014 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | NML17_RS24610 | Protein ID | WP_001034044.1 |
Coordinates | 142627..143043 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | NML17_RS24605 | Protein ID | WP_001261286.1 |
Coordinates | 142400..142630 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML17_RS24590 (137537) | 137537..137767 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
NML17_RS24595 (137764) | 137764..138180 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
NML17_RS24600 (138225) | 138225..142019 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
NML17_RS24605 (142400) | 142400..142630 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NML17_RS24610 (142627) | 142627..143043 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NML17_RS24615 (143118) | 143118..144683 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
NML17_RS24620 (144668) | 144668..145690 | + | 1023 | WP_032174242.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA | 1..164754 | 164754 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T251786 WP_001034044.1 NZ_CP101275:142627-143043 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |