Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 137537..138180 Replicon plasmid pEC21Z014-165K
Accession NZ_CP101275
Organism Escherichia coli strain EC21Z-014

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag NML17_RS24595 Protein ID WP_001034046.1
Coordinates 137764..138180 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag NML17_RS24590 Protein ID WP_001261278.1
Coordinates 137537..137767 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML17_RS24560 (133049) 133049..133354 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NML17_RS24565 (133356) 133356..133574 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
NML17_RS24570 (134164) 134164..134652 + 489 WP_011254646.1 hypothetical protein -
NML17_RS24575 (134686) 134686..135819 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
NML17_RS24580 (135986) 135986..136759 - 774 WP_000905949.1 hypothetical protein -
NML17_RS24585 (136772) 136772..137272 - 501 WP_000528932.1 HEPN family nuclease -
NML17_RS24590 (137537) 137537..137767 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NML17_RS24595 (137764) 137764..138180 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
NML17_RS24600 (138225) 138225..142019 - 3795 WP_001144732.1 hypothetical protein -
NML17_RS24605 (142400) 142400..142630 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
NML17_RS24610 (142627) 142627..143043 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA 1..164754 164754


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T251785 WP_001034046.1 NZ_CP101275:137764-138180 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT251785 WP_001261278.1 NZ_CP101275:137537-137767 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References