Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 133049..133574 Replicon plasmid pEC21Z014-165K
Accession NZ_CP101275
Organism Escherichia coli strain EC21Z-014

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NML17_RS24560 Protein ID WP_001159871.1
Coordinates 133049..133354 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NML17_RS24565 Protein ID WP_000813630.1
Coordinates 133356..133574 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML17_RS24545 (129005) 129005..130210 - 1206 WP_001442122.1 AAA family ATPase -
NML17_RS24550 (130861) 130861..131562 + 702 WP_032145561.1 replication initiation protein -
NML17_RS24555 (132242) 132242..133048 - 807 WP_000016968.1 site-specific integrase -
NML17_RS24560 (133049) 133049..133354 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NML17_RS24565 (133356) 133356..133574 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NML17_RS24570 (134164) 134164..134652 + 489 WP_011254646.1 hypothetical protein -
NML17_RS24575 (134686) 134686..135819 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
NML17_RS24580 (135986) 135986..136759 - 774 WP_000905949.1 hypothetical protein -
NML17_RS24585 (136772) 136772..137272 - 501 WP_000528932.1 HEPN family nuclease -
NML17_RS24590 (137537) 137537..137767 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
NML17_RS24595 (137764) 137764..138180 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA 1..164754 164754


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T251784 WP_001159871.1 NZ_CP101275:c133354-133049 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT251784 WP_000813630.1 NZ_CP101275:c133574-133356 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References