251778

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 76168..76703 Replicon plasmid pEC21Z014-165K
Accession NZ_CP101275
Organism Escherichia coli strain EC21Z-014

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag NML17_RS24220 Protein ID WP_000222760.1
Coordinates 76168..76455 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag NML17_RS24225 Protein ID WP_001132900.1
Coordinates 76452..76703 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML17_RS24190 (71751) 71751..72972 - 1222 Protein_68 ISL3 family transposase -
NML17_RS24195 (73072) 73072..73436 + 365 Protein_69 IS1 family transposase -
NML17_RS24200 (73491) 73491..74273 - 783 WP_001442137.1 IS21-like element IS100kyp family helper ATPase IstB -
NML17_RS24205 (74270) 74270..75292 - 1023 WP_000255956.1 IS21-like element IS100 family transposase -
NML17_RS24210 (75381) 75381..75728 + 348 Protein_72 IS1-like element IS1A family transposase -
NML17_RS24215 (75744) 75744..76064 - 321 Protein_73 serine acetyltransferase -
NML17_RS24220 (76168) 76168..76455 - 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NML17_RS24225 (76452) 76452..76703 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NML17_RS24230 (77667) 77667..78524 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
NML17_RS24235 (78517) 78517..78999 - 483 WP_001273588.1 hypothetical protein -
NML17_RS24240 (78992) 78992..79039 - 48 WP_229471593.1 hypothetical protein -
NML17_RS24245 (79030) 79030..79281 + 252 WP_223195197.1 replication protein RepA -
NML17_RS24250 (79298) 79298..79555 - 258 WP_000083845.1 replication regulatory protein RepA -
NML17_RS24255 (79839) 79839..79988 - 150 WP_001312851.1 Hok/Gef family protein -
- (80032) 80032..80093 + 62 NuclAT_1 - -
- (80032) 80032..80093 + 62 NuclAT_1 - -
- (80032) 80032..80093 + 62 NuclAT_1 - -
- (80032) 80032..80093 + 62 NuclAT_1 - -
NML17_RS24260 (80349) 80349..80423 - 75 Protein_82 endonuclease -
NML17_RS24265 (80669) 80669..80881 - 213 WP_001299730.1 ANR family transcriptional regulator -
NML17_RS24270 (81017) 81017..81577 - 561 WP_000139315.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA 1..164754 164754


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T251778 WP_000222760.1 NZ_CP101275:c76455-76168 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT251778 WP_001132900.1 NZ_CP101275:c76703-76452 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References