Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 4351057..4351857 | Replicon | chromosome |
Accession | NZ_CP101274 | ||
Organism | Escherichia coli strain EC21Z-014 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4NNI0 |
Locus tag | NML17_RS21295 | Protein ID | WP_000342449.1 |
Coordinates | 4351057..4351584 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | NML17_RS21300 | Protein ID | WP_001277108.1 |
Coordinates | 4351591..4351857 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML17_RS21270 (4346132) | 4346132..4346899 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
NML17_RS21275 (4346896) | 4346896..4348173 | - | 1278 | WP_000803771.1 | branched chain amino acid ABC transporter permease LivM | - |
NML17_RS21280 (4348170) | 4348170..4349096 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NML17_RS21285 (4349144) | 4349144..4350253 | - | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
NML17_RS21290 (4350677) | 4350677..4351060 | + | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
NML17_RS21295 (4351057) | 4351057..4351584 | - | 528 | WP_000342449.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
NML17_RS21300 (4351591) | 4351591..4351857 | - | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
NML17_RS21305 (4352007) | 4352007..4353110 | - | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
NML17_RS21310 (4353381) | 4353381..4354235 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
NML17_RS21315 (4354480) | 4354480..4355538 | - | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
NML17_RS21320 (4355531) | 4355531..4356199 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T251775 WP_000342449.1 NZ_CP101274:c4351584-4351057 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLZ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6GTS | |
PDB | 6AJN | |
PDB | 6GTQ | |
PDB | 6GTO | |
PDB | 6GTR | |
PDB | 6AJM | |
AlphaFold DB | A0A829CN24 |