Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3639675..3640258 | Replicon | chromosome |
Accession | NZ_CP101274 | ||
Organism | Escherichia coli strain EC21Z-014 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | NML17_RS17790 | Protein ID | WP_000254745.1 |
Coordinates | 3639675..3640010 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NML17_RS17795 | Protein ID | WP_000581937.1 |
Coordinates | 3640010..3640258 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML17_RS17770 (3635144) | 3635144..3635506 | + | 363 | WP_000034929.1 | hypothetical protein | - |
NML17_RS17775 (3635562) | 3635562..3636860 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
NML17_RS17780 (3636948) | 3636948..3638585 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NML17_RS17785 (3638813) | 3638813..3639604 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NML17_RS17790 (3639675) | 3639675..3640010 | - | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
NML17_RS17795 (3640010) | 3640010..3640258 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NML17_RS17800 (3640336) | 3640336..3642570 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
NML17_RS17805 (3642618) | 3642618..3643919 | - | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T251772 WP_000254745.1 NZ_CP101274:c3640010-3639675 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LMB4 |