Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3348732..3349357 | Replicon | chromosome |
| Accession | NZ_CP101274 | ||
| Organism | Escherichia coli strain EC21Z-014 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NML17_RS16355 | Protein ID | WP_000911330.1 |
| Coordinates | 3348732..3349130 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NML17_RS16360 | Protein ID | WP_000450524.1 |
| Coordinates | 3349130..3349357 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML17_RS16335 (3344610) | 3344610..3344810 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| NML17_RS16340 (3344920) | 3344920..3345618 | - | 699 | WP_000679823.1 | esterase | - |
| NML17_RS16345 (3345692) | 3345692..3347707 | - | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NML17_RS16350 (3347722) | 3347722..3348585 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| NML17_RS16355 (3348732) | 3348732..3349130 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NML17_RS16360 (3349130) | 3349130..3349357 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NML17_RS16365 (3349511) | 3349511..3350224 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NML17_RS16370 (3350437) | 3350437..3351471 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| NML17_RS16375 (3351488) | 3351488..3352366 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NML17_RS16380 (3352512) | 3352512..3353084 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NML17_RS16385 (3353084) | 3353084..3353554 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T251771 WP_000911330.1 NZ_CP101274:c3349130-3348732 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|