Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2196393..2197031 | Replicon | chromosome |
| Accession | NZ_CP101274 | ||
| Organism | Escherichia coli strain EC21Z-014 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NML17_RS10700 | Protein ID | WP_000813794.1 |
| Coordinates | 2196393..2196569 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NML17_RS10705 | Protein ID | WP_001270286.1 |
| Coordinates | 2196615..2197031 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML17_RS10680 (2192012) | 2192012..2193187 | - | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
| NML17_RS10685 (2193279) | 2193279..2193815 | + | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
| NML17_RS10690 (2193888) | 2193888..2195849 | + | 1962 | WP_208464907.1 | U32 family peptidase | - |
| NML17_RS10695 (2195941) | 2195941..2196171 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| NML17_RS10700 (2196393) | 2196393..2196569 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NML17_RS10705 (2196615) | 2196615..2197031 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NML17_RS10710 (2197110) | 2197110..2198516 | + | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| NML17_RS10715 (2198761) | 2198761..2199906 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| NML17_RS10720 (2199924) | 2199924..2200937 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NML17_RS10725 (2200938) | 2200938..2201879 | + | 942 | WP_001251319.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2190707..2191972 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T251764 WP_000813794.1 NZ_CP101274:2196393-2196569 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT251764 WP_001270286.1 NZ_CP101274:2196615-2197031 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|