Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1084342..1084960 | Replicon | chromosome |
Accession | NZ_CP101274 | ||
Organism | Escherichia coli strain EC21Z-014 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NML17_RS05180 | Protein ID | WP_001291435.1 |
Coordinates | 1084342..1084560 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NML17_RS05185 | Protein ID | WP_000344800.1 |
Coordinates | 1084586..1084960 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML17_RS05145 (1079631) | 1079631..1080203 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
NML17_RS05150 (1080234) | 1080234..1080545 | - | 312 | WP_000409911.1 | MGMT family protein | - |
NML17_RS05160 (1080924) | 1080924..1081277 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NML17_RS05165 (1081319) | 1081319..1082869 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NML17_RS05170 (1083033) | 1083033..1083503 | - | 471 | WP_000136192.1 | YlaC family protein | - |
NML17_RS05175 (1083619) | 1083619..1084170 | - | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
NML17_RS05180 (1084342) | 1084342..1084560 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NML17_RS05185 (1084586) | 1084586..1084960 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NML17_RS05190 (1085506) | 1085506..1088655 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NML17_RS05195 (1088678) | 1088678..1089871 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T251760 WP_001291435.1 NZ_CP101274:c1084560-1084342 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT251760 WP_000344800.1 NZ_CP101274:c1084960-1084586 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |