Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 1050046..1050883 | Replicon | chromosome |
| Accession | NZ_CP101274 | ||
| Organism | Escherichia coli strain EC21Z-014 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | NML17_RS05010 | Protein ID | WP_000227784.1 |
| Coordinates | 1050046..1050588 (-) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | NML17_RS05015 | Protein ID | WP_001297137.1 |
| Coordinates | 1050572..1050883 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML17_RS04990 (1045585) | 1045585..1046496 | - | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
| NML17_RS04995 (1046664) | 1046664..1047155 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| NML17_RS05000 (1047283) | 1047283..1048647 | - | 1365 | WP_001000978.1 | MFS transporter | - |
| NML17_RS05005 (1049055) | 1049055..1049990 | + | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| NML17_RS05010 (1050046) | 1050046..1050588 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| NML17_RS05015 (1050572) | 1050572..1050883 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| NML17_RS05020 (1051068) | 1051068..1051958 | - | 891 | WP_000971336.1 | heme o synthase | - |
| NML17_RS05025 (1051970) | 1051970..1052299 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| NML17_RS05030 (1052299) | 1052299..1052913 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| NML17_RS05035 (1052903) | 1052903..1054894 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| NML17_RS05040 (1054916) | 1054916..1055863 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T251759 WP_000227784.1 NZ_CP101274:c1050588-1050046 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|