Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 70214..70815 | Replicon | plasmid pEC21Z048-103K |
| Accession | NZ_CP101271 | ||
| Organism | Escherichia coli strain EC21Z-048 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9ZW91 |
| Locus tag | NML18_RS24385 | Protein ID | WP_001216033.1 |
| Coordinates | 70214..70594 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NML18_RS24390 | Protein ID | WP_001190712.1 |
| Coordinates | 70594..70815 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML18_RS24355 (NML18_24355) | 65312..65431 | - | 120 | WP_071527722.1 | ash family protein | - |
| NML18_RS24360 (NML18_24360) | 65654..67138 | - | 1485 | WP_000124159.1 | hypothetical protein | - |
| NML18_RS24365 (NML18_24365) | 67138..68331 | - | 1194 | WP_000219605.1 | terminase | - |
| NML18_RS24370 (NML18_24370) | 68418..68870 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| NML18_RS24375 (NML18_24375) | 68959..70002 | - | 1044 | WP_000648827.1 | DUF968 domain-containing protein | - |
| NML18_RS24380 (NML18_24380) | 70030..70209 | - | 180 | WP_001354541.1 | hypothetical protein | - |
| NML18_RS24385 (NML18_24385) | 70214..70594 | - | 381 | WP_001216033.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NML18_RS24390 (NML18_24390) | 70594..70815 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NML18_RS24395 (NML18_24395) | 70888..71277 | - | 390 | WP_000506724.1 | S24 family peptidase | - |
| NML18_RS24400 (NML18_24400) | 71629..72036 | + | 408 | WP_001354543.1 | hypothetical protein | - |
| NML18_RS24405 (NML18_24405) | 72037..72393 | + | 357 | WP_001062545.1 | hypothetical protein | - |
| NML18_RS24410 (NML18_24410) | 72702..73910 | + | 1209 | WP_001352368.1 | IS4-like element ISVsa5 family transposase | - |
| NML18_RS24415 (NML18_24415) | 74790..75152 | - | 363 | WP_001261543.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..102963 | 102963 | |
| - | flank | IS/Tn | - | - | 72702..73910 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13571.31 Da Isoelectric Point: 5.6343
>T251754 WP_001216033.1 NZ_CP101271:c70594-70214 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9ZW91 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |