Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 70214..70815 Replicon plasmid pEC21Z048-103K
Accession NZ_CP101271
Organism Escherichia coli strain EC21Z-048

Toxin (Protein)


Gene name doc Uniprot ID U9ZW91
Locus tag NML18_RS24385 Protein ID WP_001216033.1
Coordinates 70214..70594 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NML18_RS24390 Protein ID WP_001190712.1
Coordinates 70594..70815 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML18_RS24355 (NML18_24355) 65312..65431 - 120 WP_071527722.1 ash family protein -
NML18_RS24360 (NML18_24360) 65654..67138 - 1485 WP_000124159.1 hypothetical protein -
NML18_RS24365 (NML18_24365) 67138..68331 - 1194 WP_000219605.1 terminase -
NML18_RS24370 (NML18_24370) 68418..68870 - 453 WP_001326849.1 late promoter-activating protein -
NML18_RS24375 (NML18_24375) 68959..70002 - 1044 WP_000648827.1 DUF968 domain-containing protein -
NML18_RS24380 (NML18_24380) 70030..70209 - 180 WP_001354541.1 hypothetical protein -
NML18_RS24385 (NML18_24385) 70214..70594 - 381 WP_001216033.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NML18_RS24390 (NML18_24390) 70594..70815 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NML18_RS24395 (NML18_24395) 70888..71277 - 390 WP_000506724.1 S24 family peptidase -
NML18_RS24400 (NML18_24400) 71629..72036 + 408 WP_001354543.1 hypothetical protein -
NML18_RS24405 (NML18_24405) 72037..72393 + 357 WP_001062545.1 hypothetical protein -
NML18_RS24410 (NML18_24410) 72702..73910 + 1209 WP_001352368.1 IS4-like element ISVsa5 family transposase -
NML18_RS24415 (NML18_24415) 74790..75152 - 363 WP_001261543.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..102963 102963
- flank IS/Tn - - 72702..73910 1208


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13571.31 Da        Isoelectric Point: 5.6343

>T251754 WP_001216033.1 NZ_CP101271:c70594-70214 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT251754 WP_001190712.1 NZ_CP101271:c70815-70594 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZW91

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References