Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 63557..64182 | Replicon | plasmid pEC21Z048-116K |
Accession | NZ_CP101270 | ||
Organism | Escherichia coli strain EC21Z-048 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NML18_RS23720 | Protein ID | WP_000911324.1 |
Coordinates | 63784..64182 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | NML18_RS23715 | Protein ID | WP_000450532.1 |
Coordinates | 63557..63784 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML18_RS23715 (63557) | 63557..63784 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NML18_RS23720 (63784) | 63784..64182 | + | 399 | WP_000911324.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NML18_RS23725 (64191) | 64191..66344 | - | 2154 | WP_000009350.1 | type IV conjugative transfer system coupling protein TraD | - |
NML18_RS23730 (66597) | 66597..67307 | - | 711 | WP_042032882.1 | conjugal transfer complement resistance protein TraT | - |
NML18_RS23735 (67353) | 67353..67874 | - | 522 | WP_000632670.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | faeI / faeH / faeF / faeE / faeD / faeC | 1..115682 | 115682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14800.09 Da Isoelectric Point: 7.8604
>T251750 WP_000911324.1 NZ_CP101270:63784-64182 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|