Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 22709..23352 Replicon plasmid pEC21Z048-116K
Accession NZ_CP101270
Organism Escherichia coli strain EC21Z-048

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag NML18_RS23480 Protein ID WP_001044768.1
Coordinates 22936..23352 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag NML18_RS23475 Protein ID WP_001261287.1
Coordinates 22709..22939 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML18_RS23450 (18161) 18161..18991 - 831 WP_012565223.1 helix-turn-helix domain-containing protein -
NML18_RS23455 (19087) 19087..20295 - 1209 WP_001352368.1 IS4-like element ISVsa5 family transposase -
NML18_RS23460 (20614) 20614..21498 + 885 WP_000942222.1 helix-turn-helix domain-containing protein -
NML18_RS23465 (21781) 21781..22022 - 242 Protein_25 hypothetical protein -
NML18_RS23470 (22082) 22082..22524 + 443 Protein_26 transposase -
NML18_RS23475 (22709) 22709..22939 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NML18_RS23480 (22936) 22936..23352 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
NML18_RS23485 (23514) 23514..24731 - 1218 WP_254837472.1 IS66-like element accessory protein TnpA -
NML18_RS23490 (24762) 24762..24989 - 228 WP_000993919.1 hypothetical protein -
NML18_RS23495 (25062) 25062..25223 + 162 WP_001384894.1 hypothetical protein -
NML18_RS23500 (25595) 25595..26404 - 810 Protein_32 (S)-acetoin forming diacetyl reductase -
NML18_RS23505 (26553) 26553..26771 + 219 WP_001292878.1 hypothetical protein -
NML18_RS23510 (26814) 26814..27911 + 1098 WP_242425796.1 choloylglycine hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - faeI / faeH / faeF / faeE / faeD / faeC 1..115682 115682
- inside IScluster/Tn - - 19087..24989 5902


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T251748 WP_001044768.1 NZ_CP101270:22936-23352 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT251748 WP_001261287.1 NZ_CP101270:22709-22939 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References