Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 22709..23352 | Replicon | plasmid pEC21Z048-116K |
| Accession | NZ_CP101270 | ||
| Organism | Escherichia coli strain EC21Z-048 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | NML18_RS23480 | Protein ID | WP_001044768.1 |
| Coordinates | 22936..23352 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | NML18_RS23475 | Protein ID | WP_001261287.1 |
| Coordinates | 22709..22939 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML18_RS23450 (18161) | 18161..18991 | - | 831 | WP_012565223.1 | helix-turn-helix domain-containing protein | - |
| NML18_RS23455 (19087) | 19087..20295 | - | 1209 | WP_001352368.1 | IS4-like element ISVsa5 family transposase | - |
| NML18_RS23460 (20614) | 20614..21498 | + | 885 | WP_000942222.1 | helix-turn-helix domain-containing protein | - |
| NML18_RS23465 (21781) | 21781..22022 | - | 242 | Protein_25 | hypothetical protein | - |
| NML18_RS23470 (22082) | 22082..22524 | + | 443 | Protein_26 | transposase | - |
| NML18_RS23475 (22709) | 22709..22939 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NML18_RS23480 (22936) | 22936..23352 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NML18_RS23485 (23514) | 23514..24731 | - | 1218 | WP_254837472.1 | IS66-like element accessory protein TnpA | - |
| NML18_RS23490 (24762) | 24762..24989 | - | 228 | WP_000993919.1 | hypothetical protein | - |
| NML18_RS23495 (25062) | 25062..25223 | + | 162 | WP_001384894.1 | hypothetical protein | - |
| NML18_RS23500 (25595) | 25595..26404 | - | 810 | Protein_32 | (S)-acetoin forming diacetyl reductase | - |
| NML18_RS23505 (26553) | 26553..26771 | + | 219 | WP_001292878.1 | hypothetical protein | - |
| NML18_RS23510 (26814) | 26814..27911 | + | 1098 | WP_242425796.1 | choloylglycine hydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | faeI / faeH / faeF / faeE / faeD / faeC | 1..115682 | 115682 | |
| - | inside | IScluster/Tn | - | - | 19087..24989 | 5902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T251748 WP_001044768.1 NZ_CP101270:22936-23352 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |