Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4114325..4115160 Replicon chromosome
Accession NZ_CP101269
Organism Escherichia coli strain EC21Z-048

Toxin (Protein)


Gene name yeeV Uniprot ID A0A2S4A272
Locus tag NML18_RS20035 Protein ID WP_001094443.1
Coordinates 4114325..4114702 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7LDN9
Locus tag NML18_RS20040 Protein ID WP_001285607.1
Coordinates 4114792..4115160 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML18_RS19995 (4109355) 4109355..4110128 + 774 WP_029488485.1 type IV toxin-antitoxin system AbiEi family antitoxin -
NML18_RS20000 (4110121) 4110121..4111038 + 918 WP_000361918.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
NML18_RS20005 (4111332) 4111332..4111499 + 168 WP_001356018.1 hypothetical protein -
NML18_RS20010 (4111552) 4111552..4112214 - 663 WP_104725624.1 hypothetical protein -
NML18_RS20015 (4112287) 4112287..4112928 - 642 Protein_3916 integrase arm-type DNA-binding domain-containing protein -
NML18_RS20020 (4113395) 4113395..4113538 - 144 Protein_3917 hypothetical protein -
NML18_RS20025 (4113623) 4113623..4113820 - 198 WP_001327226.1 DUF957 domain-containing protein -
NML18_RS20030 (4113840) 4113840..4114328 - 489 WP_000761685.1 DUF5983 family protein -
NML18_RS20035 (4114325) 4114325..4114702 - 378 WP_001094443.1 TA system toxin CbtA family protein Toxin
NML18_RS20040 (4114792) 4114792..4115160 - 369 WP_001285607.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NML18_RS20045 (4115240) 4115240..4115461 - 222 WP_000692350.1 DUF987 domain-containing protein -
NML18_RS20050 (4115548) 4115548..4116024 - 477 WP_001186165.1 RadC family protein -
NML18_RS20055 (4116039) 4116039..4116524 - 486 WP_000206664.1 antirestriction protein -
NML18_RS20060 (4116616) 4116616..4117434 - 819 WP_001175163.1 DUF932 domain-containing protein -
NML18_RS20065 (4117524) 4117524..4117757 - 234 WP_001278287.1 DUF905 family protein -
NML18_RS20070 (4117763) 4117763..4118440 - 678 WP_001097301.1 hypothetical protein -
NML18_RS20075 (4118588) 4118588..4118749 - 162 Protein_3928 transcriptional regulator -
NML18_RS20080 (4118842) 4118842..4120070 + 1229 WP_089541817.1 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island tet(B) - 4107426..4165677 58251


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14058.97 Da        Isoelectric Point: 7.3523

>T251744 WP_001094443.1 NZ_CP101269:c4114702-4114325 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13689.53 Da        Isoelectric Point: 6.4669

>AT251744 WP_001285607.1 NZ_CP101269:c4115160-4114792 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S4A272

Antitoxin

Source ID Structure
AlphaFold DB A0A1M0JLU8

References