Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4114325..4115160 | Replicon | chromosome |
| Accession | NZ_CP101269 | ||
| Organism | Escherichia coli strain EC21Z-048 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A2S4A272 |
| Locus tag | NML18_RS20035 | Protein ID | WP_001094443.1 |
| Coordinates | 4114325..4114702 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7LDN9 |
| Locus tag | NML18_RS20040 | Protein ID | WP_001285607.1 |
| Coordinates | 4114792..4115160 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML18_RS19995 (4109355) | 4109355..4110128 | + | 774 | WP_029488485.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| NML18_RS20000 (4110121) | 4110121..4111038 | + | 918 | WP_000361918.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| NML18_RS20005 (4111332) | 4111332..4111499 | + | 168 | WP_001356018.1 | hypothetical protein | - |
| NML18_RS20010 (4111552) | 4111552..4112214 | - | 663 | WP_104725624.1 | hypothetical protein | - |
| NML18_RS20015 (4112287) | 4112287..4112928 | - | 642 | Protein_3916 | integrase arm-type DNA-binding domain-containing protein | - |
| NML18_RS20020 (4113395) | 4113395..4113538 | - | 144 | Protein_3917 | hypothetical protein | - |
| NML18_RS20025 (4113623) | 4113623..4113820 | - | 198 | WP_001327226.1 | DUF957 domain-containing protein | - |
| NML18_RS20030 (4113840) | 4113840..4114328 | - | 489 | WP_000761685.1 | DUF5983 family protein | - |
| NML18_RS20035 (4114325) | 4114325..4114702 | - | 378 | WP_001094443.1 | TA system toxin CbtA family protein | Toxin |
| NML18_RS20040 (4114792) | 4114792..4115160 | - | 369 | WP_001285607.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NML18_RS20045 (4115240) | 4115240..4115461 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| NML18_RS20050 (4115548) | 4115548..4116024 | - | 477 | WP_001186165.1 | RadC family protein | - |
| NML18_RS20055 (4116039) | 4116039..4116524 | - | 486 | WP_000206664.1 | antirestriction protein | - |
| NML18_RS20060 (4116616) | 4116616..4117434 | - | 819 | WP_001175163.1 | DUF932 domain-containing protein | - |
| NML18_RS20065 (4117524) | 4117524..4117757 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| NML18_RS20070 (4117763) | 4117763..4118440 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| NML18_RS20075 (4118588) | 4118588..4118749 | - | 162 | Protein_3928 | transcriptional regulator | - |
| NML18_RS20080 (4118842) | 4118842..4120070 | + | 1229 | WP_089541817.1 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | tet(B) | - | 4107426..4165677 | 58251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14058.97 Da Isoelectric Point: 7.3523
>T251744 WP_001094443.1 NZ_CP101269:c4114702-4114325 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13689.53 Da Isoelectric Point: 6.4669
>AT251744 WP_001285607.1 NZ_CP101269:c4115160-4114792 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4A272 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0JLU8 |