Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3564341..3565178 | Replicon | chromosome |
Accession | NZ_CP101269 | ||
Organism | Escherichia coli strain EC21Z-048 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NML18_RS17460 | Protein ID | WP_000227784.1 |
Coordinates | 3564636..3565178 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NML18_RS17455 | Protein ID | WP_001297137.1 |
Coordinates | 3564341..3564652 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML18_RS17430 (3559361) | 3559361..3560308 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
NML18_RS17435 (3560330) | 3560330..3562321 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NML18_RS17440 (3562311) | 3562311..3562925 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NML18_RS17445 (3562925) | 3562925..3563254 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NML18_RS17450 (3563266) | 3563266..3564156 | + | 891 | WP_000971336.1 | heme o synthase | - |
NML18_RS17455 (3564341) | 3564341..3564652 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NML18_RS17460 (3564636) | 3564636..3565178 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NML18_RS17465 (3565234) | 3565234..3566169 | - | 936 | WP_254837452.1 | tetratricopeptide repeat protein | - |
NML18_RS17470 (3566577) | 3566577..3567941 | + | 1365 | WP_001000960.1 | MFS transporter | - |
NML18_RS17475 (3568069) | 3568069..3568560 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NML18_RS17480 (3568728) | 3568728..3569639 | + | 912 | WP_104725566.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T251741 WP_000227784.1 NZ_CP101269:3564636-3565178 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|