Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3530262..3530880 | Replicon | chromosome |
Accession | NZ_CP101269 | ||
Organism | Escherichia coli strain EC21Z-048 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NML18_RS17290 | Protein ID | WP_001291435.1 |
Coordinates | 3530662..3530880 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NML18_RS17285 | Protein ID | WP_000344800.1 |
Coordinates | 3530262..3530636 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML18_RS17275 (3525351) | 3525351..3526544 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NML18_RS17280 (3526567) | 3526567..3529716 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NML18_RS17285 (3530262) | 3530262..3530636 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NML18_RS17290 (3530662) | 3530662..3530880 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NML18_RS17295 (3531052) | 3531052..3531603 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NML18_RS17300 (3531719) | 3531719..3532189 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NML18_RS17305 (3532353) | 3532353..3533903 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NML18_RS17310 (3533945) | 3533945..3534298 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
NML18_RS17320 (3534677) | 3534677..3534988 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NML18_RS17325 (3535019) | 3535019..3535591 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T251740 WP_001291435.1 NZ_CP101269:3530662-3530880 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT251740 WP_000344800.1 NZ_CP101269:3530262-3530636 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |