Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2508896..2509534 | Replicon | chromosome |
| Accession | NZ_CP101269 | ||
| Organism | Escherichia coli strain EC21Z-048 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NML18_RS12290 | Protein ID | WP_000813794.1 |
| Coordinates | 2509358..2509534 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NML18_RS12285 | Protein ID | WP_001270286.1 |
| Coordinates | 2508896..2509312 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML18_RS12265 (2504048) | 2504048..2504989 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| NML18_RS12270 (2504990) | 2504990..2506003 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
| NML18_RS12275 (2506021) | 2506021..2507166 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| NML18_RS12280 (2507411) | 2507411..2508817 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| NML18_RS12285 (2508896) | 2508896..2509312 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NML18_RS12290 (2509358) | 2509358..2509534 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NML18_RS12295 (2509756) | 2509756..2509986 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NML18_RS12300 (2510078) | 2510078..2512039 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NML18_RS12305 (2512112) | 2512112..2512648 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| NML18_RS12310 (2512740) | 2512740..2513915 | + | 1176 | WP_001236258.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T251739 WP_000813794.1 NZ_CP101269:c2509534-2509358 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT251739 WP_001270286.1 NZ_CP101269:c2509312-2508896 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|