Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 6299..6821 Replicon plasmid pEC21Z063-47K
Accession NZ_CP101266
Organism Escherichia coli strain EC21Z-063

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag NML19_RS24045 Protein ID WP_000220560.1
Coordinates 6540..6821 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NML19_RS24040 Protein ID WP_000121743.1
Coordinates 6299..6550 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML19_RS24010 (NML19_24005) 1662..1892 + 231 WP_000051064.1 plasmid partition protein ParG -
NML19_RS24015 (NML19_24010) 1908..2201 + 294 WP_015060510.1 hypothetical protein -
NML19_RS24020 (NML19_24015) 2203..3171 + 969 WP_077249520.1 IS5-like element IS903B family transposase -
NML19_RS24025 (NML19_24020) 3231..3584 - 354 WP_000876434.1 DNA distortion polypeptide 3 -
NML19_RS24030 (NML19_24025) 3721..4167 - 447 WP_001074386.1 hypothetical protein -
NML19_RS24035 (NML19_24030) 4207..5043 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
NML19_RS24040 (NML19_24035) 6299..6550 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NML19_RS24045 (NML19_24040) 6540..6821 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NML19_RS24050 (NML19_24045) 6967..7290 + 324 WP_001181903.1 hypothetical protein -
NML19_RS24055 (NML19_24050) 7335..7580 + 246 WP_000356546.1 hypothetical protein -
NML19_RS24060 (NML19_24055) 7570..7785 + 216 WP_001180116.1 hypothetical protein -
NML19_RS24065 (NML19_24060) 7878..8207 + 330 WP_000866648.1 hypothetical protein -
NML19_RS24070 (NML19_24065) 8494..8643 + 150 WP_000003880.1 hypothetical protein -
NML19_RS24075 (NML19_24070) 8656..8928 + 273 WP_000160399.1 hypothetical protein -
NML19_RS24080 (NML19_24075) 9255..9800 + 546 WP_038976855.1 DNA distortion polypeptide 1 -
NML19_RS24085 (NML19_24080) 9803..10960 + 1158 WP_000538023.1 DNA distortion polypeptide 2 -
NML19_RS24090 (NML19_24085) 11321..11812 + 492 WP_000872475.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / blaCTX-M-55 / qnrS1 / tet(A) - 1..46712 46712
- flank IS/Tn - - 2248..3171 923


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T251727 WP_000220560.1 NZ_CP101266:6540-6821 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT251727 WP_000121743.1 NZ_CP101266:6299-6550 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References