Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2488923..2489561 | Replicon | chromosome |
| Accession | NZ_CP101263 | ||
| Organism | Escherichia coli strain EC21Z-063 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NML19_RS12175 | Protein ID | WP_000813794.1 |
| Coordinates | 2489385..2489561 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NML19_RS12170 | Protein ID | WP_001270286.1 |
| Coordinates | 2488923..2489339 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML19_RS12150 (2484075) | 2484075..2485016 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| NML19_RS12155 (2485017) | 2485017..2486030 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
| NML19_RS12160 (2486048) | 2486048..2487193 | - | 1146 | WP_254825086.1 | ABC transporter substrate-binding protein | - |
| NML19_RS12165 (2487438) | 2487438..2488844 | - | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
| NML19_RS12170 (2488923) | 2488923..2489339 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NML19_RS12175 (2489385) | 2489385..2489561 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NML19_RS12180 (2489783) | 2489783..2490013 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NML19_RS12185 (2490105) | 2490105..2492066 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NML19_RS12190 (2492139) | 2492139..2492675 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
| NML19_RS12195 (2492767) | 2492767..2493942 | + | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2493982..2495247 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T251719 WP_000813794.1 NZ_CP101263:c2489561-2489385 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT251719 WP_001270286.1 NZ_CP101263:c2489339-2488923 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|