Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1010497..1011080 | Replicon | chromosome |
Accession | NZ_CP101263 | ||
Organism | Escherichia coli strain EC21Z-063 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | NML19_RS04845 | Protein ID | WP_000254738.1 |
Coordinates | 1010745..1011080 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NML19_RS04840 | Protein ID | WP_000581937.1 |
Coordinates | 1010497..1010745 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML19_RS04830 (1006836) | 1006836..1008137 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
NML19_RS04835 (1008185) | 1008185..1010419 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
NML19_RS04840 (1010497) | 1010497..1010745 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NML19_RS04845 (1010745) | 1010745..1011080 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
NML19_RS04850 (1011151) | 1011151..1011942 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NML19_RS04855 (1012170) | 1012170..1013807 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NML19_RS04860 (1013895) | 1013895..1015193 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T251712 WP_000254738.1 NZ_CP101263:1010745-1011080 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|