Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 794997..795795 | Replicon | chromosome |
Accession | NZ_CP101263 | ||
Organism | Escherichia coli strain EC21Z-063 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1M0HL60 |
Locus tag | NML19_RS03845 | Protein ID | WP_000854692.1 |
Coordinates | 794997..795374 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1L4NTN5 |
Locus tag | NML19_RS03850 | Protein ID | WP_001605875.1 |
Coordinates | 795421..795795 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML19_RS03815 (790125) | 790125..791273 | - | 1149 | WP_000905922.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
NML19_RS03820 (791345) | 791345..792328 | - | 984 | WP_001331698.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
NML19_RS03825 (793139) | 793139..793309 | - | 171 | Protein_750 | IS110 family transposase | - |
NML19_RS03830 (793651) | 793651..794493 | - | 843 | WP_001529559.1 | DUF4942 domain-containing protein | - |
NML19_RS03835 (794578) | 794578..794775 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
NML19_RS03840 (794851) | 794851..795000 | - | 150 | Protein_753 | DUF5983 family protein | - |
NML19_RS03845 (794997) | 794997..795374 | - | 378 | WP_000854692.1 | TA system toxin CbtA family protein | Toxin |
NML19_RS03850 (795421) | 795421..795795 | - | 375 | WP_001605875.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
NML19_RS03855 (795869) | 795869..796090 | - | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
NML19_RS03860 (796159) | 796159..796635 | - | 477 | WP_254825142.1 | RadC family protein | - |
NML19_RS03865 (796651) | 796651..797136 | - | 486 | WP_254825143.1 | antirestriction protein | - |
NML19_RS03870 (797228) | 797228..798046 | - | 819 | WP_001610805.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14119.12 Da Isoelectric Point: 7.3249
>T251710 WP_000854692.1 NZ_CP101263:c795374-794997 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWHTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
MKTLPDTHVREASCCPSPVTIWHTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13594.42 Da Isoelectric Point: 5.4554
>AT251710 WP_001605875.1 NZ_CP101263:c795795-795421 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0HL60 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1L4NTN5 |