Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1317970..1318595 | Replicon | chromosome |
| Accession | NZ_CP101257 | ||
| Organism | Escherichia coli strain EC21Z-078 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NML20_RS06390 | Protein ID | WP_000911330.1 |
| Coordinates | 1318197..1318595 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NML20_RS06385 | Protein ID | WP_000450524.1 |
| Coordinates | 1317970..1318197 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML20_RS06360 (1313773) | 1313773..1314243 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| NML20_RS06365 (1314243) | 1314243..1314815 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NML20_RS06370 (1314961) | 1314961..1315839 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NML20_RS06375 (1315856) | 1315856..1316890 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| NML20_RS06380 (1317103) | 1317103..1317816 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NML20_RS06385 (1317970) | 1317970..1318197 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NML20_RS06390 (1318197) | 1318197..1318595 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NML20_RS06395 (1318742) | 1318742..1319605 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| NML20_RS06400 (1319620) | 1319620..1321635 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NML20_RS06405 (1321709) | 1321709..1322407 | + | 699 | WP_000679823.1 | esterase | - |
| NML20_RS06410 (1322517) | 1322517..1322717 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T251685 WP_000911330.1 NZ_CP101257:1318197-1318595 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|