Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
Location | 4284029..4285073 | Replicon | chromosome |
Accession | NZ_CP101251 | ||
Organism | Escherichia coli strain EC21Z-083 |
Toxin (Protein)
Gene name | panT | Uniprot ID | A0A829CP20 |
Locus tag | NML21_RS20875 | Protein ID | WP_000019186.1 |
Coordinates | 4284029..4284577 (-) | Length | 183 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | A0A839B6W4 |
Locus tag | NML21_RS20880 | Protein ID | WP_000287252.1 |
Coordinates | 4284600..4285073 (-) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML21_RS20835 (4279353) | 4279353..4279418 | - | 66 | Protein_4070 | phage minor tail protein L | - |
NML21_RS20840 (4279418) | 4279418..4279792 | - | 375 | Protein_4071 | hypothetical protein | - |
NML21_RS20845 (4279836) | 4279836..4280036 | - | 201 | WP_000649477.1 | YdaS family helix-turn-helix protein | - |
NML21_RS20850 (4280127) | 4280127..4280801 | + | 675 | WP_000859462.1 | LexA family transcriptional repressor | - |
NML21_RS20855 (4281468) | 4281468..4281830 | + | 363 | WP_000135680.1 | protein YfdP | - |
NML21_RS20860 (4281896) | 4281896..4282720 | + | 825 | WP_001753751.1 | DUF2303 family protein | - |
NML21_RS20865 (4282907) | 4282907..4283689 | + | 783 | WP_000610754.1 | hypothetical protein | - |
NML21_RS20870 (4283726) | 4283726..4283995 | + | 270 | WP_001093912.1 | pyocin activator PrtN family protein | - |
NML21_RS20875 (4284029) | 4284029..4284577 | - | 549 | WP_000019186.1 | hypothetical protein | Toxin |
NML21_RS20880 (4284600) | 4284600..4285073 | - | 474 | WP_000287252.1 | DUF4065 domain-containing protein | Antitoxin |
NML21_RS20885 (4285378) | 4285378..4285482 | - | 105 | Protein_4080 | tRNA-dihydrouridine synthase | - |
NML21_RS20890 (4285845) | 4285845..4286861 | - | 1017 | WP_000912595.1 | DUF2713 family protein | - |
NML21_RS20895 (4287179) | 4287179..4287694 | + | 516 | WP_001295691.1 | zinc uptake transcriptional repressor Zur | - |
NML21_RS20900 (4287736) | 4287736..4287945 | - | 210 | WP_001030593.1 | CsbD family protein | - |
NML21_RS20905 (4288061) | 4288061..4289386 | - | 1326 | WP_001301116.1 | MATE family efflux transporter DinF | - |
NML21_RS20910 (4289459) | 4289459..4290067 | - | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4268437..4290067 | 21630 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 183 a.a. Molecular weight: 20026.39 Da Isoelectric Point: 4.4481
>T251664 WP_000019186.1 NZ_CP101251:c4284577-4284029 [Escherichia coli]
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
Download Length: 549 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17298.80 Da Isoelectric Point: 8.4143
>AT251664 WP_000287252.1 NZ_CP101251:c4285073-4284600 [Escherichia coli]
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CP20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A839B6W4 |