Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
Location | 4284151..4285195 | Replicon | chromosome |
Accession | NZ_CP101245 | ||
Organism | Escherichia coli strain EC21Z-097 |
Toxin (Protein)
Gene name | panT | Uniprot ID | A0A829CP20 |
Locus tag | NML22_RS20895 | Protein ID | WP_000019186.1 |
Coordinates | 4284151..4284699 (-) | Length | 183 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | A0A839B6W4 |
Locus tag | NML22_RS20900 | Protein ID | WP_000287252.1 |
Coordinates | 4284722..4285195 (-) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML22_RS20855 (4279475) | 4279475..4279540 | - | 66 | Protein_4074 | phage minor tail protein L | - |
NML22_RS20860 (4279540) | 4279540..4279914 | - | 375 | Protein_4075 | hypothetical protein | - |
NML22_RS20865 (4279958) | 4279958..4280158 | - | 201 | WP_000649477.1 | YdaS family helix-turn-helix protein | - |
NML22_RS20870 (4280249) | 4280249..4280923 | + | 675 | WP_000859462.1 | LexA family transcriptional repressor | - |
NML22_RS20875 (4281590) | 4281590..4281952 | + | 363 | WP_000135680.1 | protein YfdP | - |
NML22_RS20880 (4282018) | 4282018..4282842 | + | 825 | WP_001753751.1 | DUF2303 family protein | - |
NML22_RS20885 (4283029) | 4283029..4283811 | + | 783 | WP_000610754.1 | hypothetical protein | - |
NML22_RS20890 (4283848) | 4283848..4284117 | + | 270 | WP_001093912.1 | pyocin activator PrtN family protein | - |
NML22_RS20895 (4284151) | 4284151..4284699 | - | 549 | WP_000019186.1 | hypothetical protein | Toxin |
NML22_RS20900 (4284722) | 4284722..4285195 | - | 474 | WP_000287252.1 | DUF4065 domain-containing protein | Antitoxin |
NML22_RS20905 (4285500) | 4285500..4285604 | - | 105 | Protein_4084 | tRNA-dihydrouridine synthase | - |
NML22_RS20910 (4285967) | 4285967..4286983 | - | 1017 | WP_000912595.1 | DUF2713 family protein | - |
NML22_RS20915 (4287301) | 4287301..4287816 | + | 516 | WP_001295691.1 | zinc uptake transcriptional repressor Zur | - |
NML22_RS20920 (4287858) | 4287858..4288067 | - | 210 | WP_001030593.1 | CsbD family protein | - |
NML22_RS20925 (4288183) | 4288183..4289508 | - | 1326 | WP_001301116.1 | MATE family efflux transporter DinF | - |
NML22_RS20930 (4289581) | 4289581..4290189 | - | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4268559..4290189 | 21630 | |
- | inside | Prophage | - | - | 4268559..4290667 | 22108 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 183 a.a. Molecular weight: 20026.39 Da Isoelectric Point: 4.4481
>T251635 WP_000019186.1 NZ_CP101245:c4284699-4284151 [Escherichia coli]
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
Download Length: 549 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17298.80 Da Isoelectric Point: 8.4143
>AT251635 WP_000287252.1 NZ_CP101245:c4285195-4284722 [Escherichia coli]
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CP20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A839B6W4 |