Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 51884..52485 Replicon plasmid pEC21Z101-80K
Accession NZ_CP101242
Organism Escherichia coli strain EC21Z-101

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag NML23_RS23470 Protein ID WP_001216045.1
Coordinates 51884..52264 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NML23_RS23475 Protein ID WP_001190712.1
Coordinates 52264..52485 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML23_RS23445 (NML23_23445) 47325..48809 - 1485 WP_000124150.1 terminase -
NML23_RS23450 (NML23_23450) 48809..50002 - 1194 WP_000219625.1 hypothetical protein -
NML23_RS23455 (NML23_23455) 50088..50540 - 453 WP_001326849.1 late promoter-activating protein -
NML23_RS23460 (NML23_23460) 50629..51672 - 1044 WP_023356283.1 DUF968 domain-containing protein -
NML23_RS23465 (NML23_23465) 51700..51879 - 180 WP_001339207.1 hypothetical protein -
NML23_RS23470 (NML23_23470) 51884..52264 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NML23_RS23475 (NML23_23475) 52264..52485 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NML23_RS23480 (NML23_23480) 52558..52947 - 390 WP_000506730.1 S24 family peptidase -
NML23_RS23485 (NML23_23485) 53122..53361 + 240 WP_223368633.1 hypothetical protein -
NML23_RS23490 (NML23_23490) 53339..53713 + 375 Protein_55 integrase core domain-containing protein -
NML23_RS23495 (NML23_23495) 54284..54889 - 606 WP_254825251.1 SGNH hydrolase domain-containing protein -
NML23_RS23505 (NML23_23505) 55658..56917 - 1260 WP_254825252.1 acyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..80388 80388


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T251619 WP_001216045.1 NZ_CP101242:c52264-51884 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT251619 WP_001190712.1 NZ_CP101242:c52485-52264 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References