Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3415198..3415816 | Replicon | chromosome |
Accession | NZ_CP101240 | ||
Organism | Escherichia coli strain EC21Z-101 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NML23_RS16610 | Protein ID | WP_001291435.1 |
Coordinates | 3415598..3415816 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NML23_RS16605 | Protein ID | WP_000344800.1 |
Coordinates | 3415198..3415572 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML23_RS16595 (3410287) | 3410287..3411480 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NML23_RS16600 (3411503) | 3411503..3414652 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NML23_RS16605 (3415198) | 3415198..3415572 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NML23_RS16610 (3415598) | 3415598..3415816 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NML23_RS16615 (3415988) | 3415988..3416539 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
NML23_RS16620 (3416655) | 3416655..3417125 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NML23_RS16625 (3417289) | 3417289..3418839 | + | 1551 | WP_001372022.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NML23_RS16630 (3418881) | 3418881..3419234 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NML23_RS16640 (3419613) | 3419613..3419924 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NML23_RS16645 (3419955) | 3419955..3420527 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T251611 WP_001291435.1 NZ_CP101240:3415598-3415816 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT251611 WP_000344800.1 NZ_CP101240:3415198-3415572 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |