Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
| Location | 47131..47929 | Replicon | plasmid pEC21Z137-115K |
| Accession | NZ_CP101235 | ||
| Organism | Escherichia coli strain EC21Z-137 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | NML24_RS23510 | Protein ID | WP_089075245.1 |
| Coordinates | 47408..47929 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A141BRA2 |
| Locus tag | NML24_RS23505 | Protein ID | WP_001711191.1 |
| Coordinates | 47131..47400 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML24_RS23480 (NML24_23445) | 42555..43895 | - | 1341 | WP_023135655.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NML24_RS23485 (NML24_23450) | 43956..44681 | - | 726 | WP_087904723.1 | hypothetical protein | - |
| NML24_RS23490 (NML24_23455) | 44964..45731 | + | 768 | WP_001711193.1 | hypothetical protein | - |
| NML24_RS23495 (NML24_23460) | 45784..46137 | - | 354 | WP_160378290.1 | hypothetical protein | - |
| NML24_RS23500 (NML24_23465) | 46143..46811 | - | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
| NML24_RS23505 (NML24_23470) | 47131..47400 | + | 270 | WP_001711191.1 | DUF1778 domain-containing protein | Antitoxin |
| NML24_RS23510 (NML24_23475) | 47408..47929 | + | 522 | WP_089075245.1 | GNAT family N-acetyltransferase | Toxin |
| NML24_RS23515 (NML24_23480) | 48098..48349 | - | 252 | WP_254841648.1 | hypothetical protein | - |
| NML24_RS23520 (NML24_23485) | 48352..49044 | - | 693 | WP_024172707.1 | membrane protein | - |
| NML24_RS23525 (NML24_23490) | 49058..49381 | - | 324 | WP_001711185.1 | hypothetical protein | - |
| NML24_RS23530 (NML24_23495) | 49515..50096 | - | 582 | WP_032187799.1 | tail fiber assembly protein | - |
| NML24_RS23535 (NML24_23500) | 50096..52810 | - | 2715 | WP_254841650.1 | tail fiber protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..115200 | 115200 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19368.15 Da Isoelectric Point: 7.8112
>T251593 WP_089075245.1 NZ_CP101235:47408-47929 [Escherichia coli]
VSNTTIEIFSGENDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEEIPKVLGYYTLSGSCFEKETLPSKSQQ
KKVPYRHVPSITLGRLALDKSLQGQGLGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKARAFYKSLGFIQLVGNNDRSL
FYPTKSIEKLFEE
VSNTTIEIFSGENDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEEIPKVLGYYTLSGSCFEKETLPSKSQQ
KKVPYRHVPSITLGRLALDKSLQGQGLGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKARAFYKSLGFIQLVGNNDRSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|