Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 40551..41149 | Replicon | plasmid pEC21Z137-115K |
| Accession | NZ_CP101235 | ||
| Organism | Escherichia coli strain EC21Z-137 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | NML24_RS23470 | Protein ID | WP_032187669.1 |
| Coordinates | 40772..41149 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | L4J1C0 |
| Locus tag | NML24_RS23465 | Protein ID | WP_001603498.1 |
| Coordinates | 40551..40772 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML24_RS23445 (NML24_23410) | 35557..36105 | + | 549 | WP_032187673.1 | fimbrial protein YehD | - |
| NML24_RS23450 (NML24_23415) | 36161..36841 | + | 681 | WP_032187672.1 | fimbrial assembly chaperone | - |
| NML24_RS23455 (NML24_23420) | 36859..39345 | + | 2487 | WP_212403473.1 | fimbrial biogenesis outer membrane usher protein | - |
| NML24_RS23460 (NML24_23425) | 39356..40366 | + | 1011 | WP_254841647.1 | fimbrial protein | - |
| NML24_RS23465 (NML24_23430) | 40551..40772 | + | 222 | WP_001603498.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NML24_RS23470 (NML24_23435) | 40772..41149 | + | 378 | WP_032187669.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NML24_RS23475 (NML24_23440) | 41283..42467 | - | 1185 | WP_050489703.1 | DNA primase | - |
| NML24_RS23480 (NML24_23445) | 42555..43895 | - | 1341 | WP_023135655.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NML24_RS23485 (NML24_23450) | 43956..44681 | - | 726 | WP_087904723.1 | hypothetical protein | - |
| NML24_RS23490 (NML24_23455) | 44964..45731 | + | 768 | WP_001711193.1 | hypothetical protein | - |
| NML24_RS23495 (NML24_23460) | 45784..46137 | - | 354 | WP_160378290.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..115200 | 115200 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13465.18 Da Isoelectric Point: 6.2257
>T251592 WP_032187669.1 NZ_CP101235:40772-41149 [Escherichia coli]
MRHISPEELTAIHDANISRYGGLPGMSDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA
MRHISPEELTAIHDANISRYGGLPGMSDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|