Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3324472..3325090 | Replicon | chromosome |
Accession | NZ_CP101233 | ||
Organism | Escherichia coli strain EC21Z-137 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NML24_RS16150 | Protein ID | WP_001291435.1 |
Coordinates | 3324872..3325090 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NML24_RS16145 | Protein ID | WP_000344800.1 |
Coordinates | 3324472..3324846 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML24_RS16135 (3319561) | 3319561..3320754 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NML24_RS16140 (3320777) | 3320777..3323926 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NML24_RS16145 (3324472) | 3324472..3324846 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NML24_RS16150 (3324872) | 3324872..3325090 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NML24_RS16155 (3325262) | 3325262..3325813 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NML24_RS16160 (3325929) | 3325929..3326399 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NML24_RS16165 (3326563) | 3326563..3328113 | + | 1551 | WP_077477703.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NML24_RS16170 (3328155) | 3328155..3328508 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NML24_RS16180 (3328887) | 3328887..3329198 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NML24_RS16185 (3329229) | 3329229..3329801 | - | 573 | WP_077477690.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T251588 WP_001291435.1 NZ_CP101233:3324872-3325090 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT251588 WP_000344800.1 NZ_CP101233:3324472-3324846 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |