Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2317922..2318560 | Replicon | chromosome |
| Accession | NZ_CP101233 | ||
| Organism | Escherichia coli strain EC21Z-137 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NML24_RS11230 | Protein ID | WP_000813794.1 |
| Coordinates | 2318384..2318560 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NML24_RS11225 | Protein ID | WP_001270286.1 |
| Coordinates | 2317922..2318338 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML24_RS11205 (2313074) | 2313074..2314015 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| NML24_RS11210 (2314016) | 2314016..2315029 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
| NML24_RS11215 (2315047) | 2315047..2316192 | - | 1146 | WP_087902524.1 | ABC transporter substrate-binding protein | - |
| NML24_RS11220 (2316437) | 2316437..2317843 | - | 1407 | WP_254841565.1 | PLP-dependent aminotransferase family protein | - |
| NML24_RS11225 (2317922) | 2317922..2318338 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NML24_RS11230 (2318384) | 2318384..2318560 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NML24_RS11235 (2318782) | 2318782..2319012 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NML24_RS11240 (2319104) | 2319104..2321065 | - | 1962 | WP_212403047.1 | U32 family peptidase | - |
| NML24_RS11245 (2321138) | 2321138..2321674 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
| NML24_RS11250 (2321766) | 2321766..2322941 | + | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2322981..2324246 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T251587 WP_000813794.1 NZ_CP101233:c2318560-2318384 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT251587 WP_001270286.1 NZ_CP101233:c2318338-2317922 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|