Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 29288..29789 Replicon plasmid pEC21Z144-36K
Accession NZ_CP101227
Organism Escherichia coli strain EC21Z-144

Toxin (Protein)


Gene name TsxA Uniprot ID A0A2S5RIK4
Locus tag NML25_RS27000 Protein ID WP_022645141.1
Coordinates 29529..29789 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID A0A2S5RIE4
Locus tag NML25_RS26995 Protein ID WP_022645142.1
Coordinates 29288..29539 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML25_RS26960 (NML25_26955) 24370..24819 - 450 WP_156669393.1 hypothetical protein -
NML25_RS26965 (NML25_26960) 24755..25273 - 519 WP_112888876.1 transcription termination/antitermination NusG family protein -
NML25_RS26970 (NML25_26965) 25640..26794 - 1155 WP_112888877.1 MobP1 family relaxase -
NML25_RS26975 (NML25_26970) 26797..27339 - 543 WP_112888882.1 hypothetical protein -
NML25_RS26980 (NML25_26975) 27755..27976 - 222 WP_032716102.1 hypothetical protein -
NML25_RS26985 (NML25_26980) 28184..28366 - 183 WP_000373383.1 hypothetical protein -
NML25_RS26990 (NML25_26985) 28409..28738 - 330 WP_032716100.1 hypothetical protein -
NML25_RS26995 (NML25_26990) 29288..29539 - 252 WP_022645142.1 transcriptional regulator Antitoxin
NML25_RS27000 (NML25_26995) 29529..29789 - 261 WP_022645141.1 hypothetical protein Toxin
NML25_RS27005 (NML25_27000) 29841..30065 - 225 WP_112888878.1 hypothetical protein -
NML25_RS27010 (NML25_27005) 30163..30372 - 210 WP_032716096.1 hypothetical protein -
NML25_RS27015 (NML25_27010) 30413..30739 - 327 WP_032716095.1 hypothetical protein -
NML25_RS27020 (NML25_27015) 31351..31677 - 327 WP_112888879.1 DNA-binding protein -
NML25_RS27025 (NML25_27020) 31692..31973 - 282 WP_000780222.1 helix-turn-helix transcriptional regulator -
NML25_RS27030 (NML25_27025) 31954..32283 - 330 WP_001541974.1 type II toxin-antitoxin system RelE/ParE family toxin -
NML25_RS27035 (NML25_27030) 33301..33366 - 66 Protein_47 hypothetical protein -
NML25_RS27040 (NML25_27035) 33460..34605 - 1146 WP_000976514.1 class C beta-lactamase CMY-2 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCMY-2 - 1..36377 36377
- flank IS/Tn blaCMY-2 - 33460..36191 2731


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9876.23 Da        Isoelectric Point: 7.2030

>T251575 WP_022645141.1 NZ_CP101227:c29789-29529 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEEAFDTIDFASDGLRENDKEIVSMMIQEMS
EEKNAN

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9407.81 Da        Isoelectric Point: 9.8120

>AT251575 WP_022645142.1 NZ_CP101227:c29539-29288 [Escherichia coli]
MLTENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S5RIK4

Antitoxin

Source ID Structure
AlphaFold DB A0A2S5RIE4

References