Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 72634..73159 | Replicon | plasmid pEC21Z144-89K |
Accession | NZ_CP101224 | ||
Organism | Escherichia coli strain EC21Z-144 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | NML25_RS25930 | Protein ID | WP_001159868.1 |
Coordinates | 72634..72939 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | NML25_RS25935 | Protein ID | WP_000813634.1 |
Coordinates | 72941..73159 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML25_RS25915 (68544) | 68544..69710 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
NML25_RS25920 (70298) | 70298..71053 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
NML25_RS25925 (71827) | 71827..72633 | - | 807 | WP_000016982.1 | site-specific integrase | - |
NML25_RS25930 (72634) | 72634..72939 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NML25_RS25935 (72941) | 72941..73159 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NML25_RS25940 (73867) | 73867..74862 | + | 996 | WP_000246635.1 | hypothetical protein | - |
NML25_RS25945 (74866) | 74866..75798 | + | 933 | WP_000991831.1 | S-4TM family putative pore-forming effector | - |
NML25_RS25950 (76096) | 76096..77184 | + | 1089 | WP_000952231.1 | hypothetical protein | - |
NML25_RS25955 (77186) | 77186..78055 | + | 870 | WP_001586225.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(3)-IId / blaTEM-1B | - | 1..88826 | 88826 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T251573 WP_001159868.1 NZ_CP101224:c72939-72634 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|