Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4089301..4090136 Replicon chromosome
Accession NZ_CP101222
Organism Escherichia coli strain EC21Z-144

Toxin (Protein)


Gene name yeeV Uniprot ID A0A2I6T1R7
Locus tag NML25_RS19650 Protein ID WP_016231184.1
Coordinates 4089759..4090136 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7Z1I923
Locus tag NML25_RS19645 Protein ID WP_016231183.1
Coordinates 4089301..4089669 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML25_RS19605 (4085287) 4085287..4085634 - 348 WP_000612617.1 IS66 family insertion sequence element accessory protein TnpB -
NML25_RS19610 (4085631) 4085631..4086035 - 405 WP_016231180.1 transposase -
NML25_RS19615 (4086121) 4086121..4086354 + 234 WP_001119719.1 DUF905 family protein -
NML25_RS19620 (4086454) 4086454..4087272 + 819 WP_023909039.1 DUF932 domain-containing protein -
NML25_RS19625 (4087327) 4087327..4087812 + 486 WP_000849596.1 antirestriction protein -
NML25_RS19630 (4087828) 4087828..4088304 + 477 WP_001186774.1 RadC family protein -
NML25_RS19635 (4088367) 4088367..4088588 + 222 WP_016231182.1 DUF987 domain-containing protein -
NML25_RS19640 (4088607) 4088607..4089251 + 645 Protein_3832 antitoxin of toxin-antitoxin stability system -
NML25_RS19645 (4089301) 4089301..4089669 + 369 WP_016231183.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NML25_RS19650 (4089759) 4089759..4090136 + 378 WP_016231184.1 TA system toxin CbtA family protein Toxin
NML25_RS19655 (4090133) 4090133..4090621 + 489 WP_016231185.1 DUF5983 family protein -
NML25_RS19660 (4090633) 4090633..4090830 + 198 WP_016231186.1 DUF957 domain-containing protein -
NML25_RS19665 (4090927) 4090927..4091496 + 570 WP_001290252.1 DUF4942 domain-containing protein -
NML25_RS19670 (4091838) 4091838..4092008 + 171 Protein_3838 IS110 family transposase -
NML25_RS19675 (4092819) 4092819..4093802 + 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
NML25_RS19680 (4093874) 4093874..4095022 + 1149 WP_000905926.1 capsule polysaccharide export inner-membrane protein KpsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14106.07 Da        Isoelectric Point: 8.2905

>T251560 WP_016231184.1 NZ_CP101222:4089759-4090136 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13613.43 Da        Isoelectric Point: 6.8413

>AT251560 WP_016231183.1 NZ_CP101222:4089301-4089669 [Escherichia coli]
MSDTLPGTTLPDNNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I6T1R7

Antitoxin

Source ID Structure
AlphaFold DB A0A7Z1I923

References