Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3950084..3950738 | Replicon | chromosome |
Accession | NZ_CP101222 | ||
Organism | Escherichia coli strain EC21Z-144 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NML25_RS18890 | Protein ID | WP_000244781.1 |
Coordinates | 3950084..3950491 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NML25_RS18895 | Protein ID | WP_000354046.1 |
Coordinates | 3950472..3950738 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML25_RS18870 (3946041) | 3946041..3947774 | - | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NML25_RS18875 (3947780) | 3947780..3948490 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NML25_RS18880 (3948515) | 3948515..3949411 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NML25_RS18885 (3949523) | 3949523..3950044 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NML25_RS18890 (3950084) | 3950084..3950491 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
NML25_RS18895 (3950472) | 3950472..3950738 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NML25_RS18900 (3950981) | 3950981..3951961 | + | 981 | WP_000886079.1 | tRNA-modifying protein YgfZ | - |
NML25_RS18905 (3952038) | 3952038..3952697 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
NML25_RS18910 (3952861) | 3952861..3953172 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
NML25_RS18915 (3953217) | 3953217..3954650 | + | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T251559 WP_000244781.1 NZ_CP101222:c3950491-3950084 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|