Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2285964..2286602 | Replicon | chromosome |
Accession | NZ_CP101222 | ||
Organism | Escherichia coli strain EC21Z-144 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
Locus tag | NML25_RS11030 | Protein ID | WP_000813795.1 |
Coordinates | 2285964..2286140 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NML25_RS11035 | Protein ID | WP_076797675.1 |
Coordinates | 2286186..2286602 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML25_RS11010 (2281586) | 2281586..2282758 | - | 1173 | WP_001551088.1 | BenE family transporter YdcO | - |
NML25_RS11015 (2282850) | 2282850..2283386 | + | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
NML25_RS11020 (2283459) | 2283459..2285420 | + | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NML25_RS11025 (2285512) | 2285512..2285742 | - | 231 | WP_023910283.1 | YncJ family protein | - |
NML25_RS11030 (2285964) | 2285964..2286140 | + | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NML25_RS11035 (2286186) | 2286186..2286602 | + | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NML25_RS11040 (2286681) | 2286681..2288087 | + | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
NML25_RS11045 (2288332) | 2288332..2289477 | + | 1146 | Protein_2150 | ABC transporter substrate-binding protein | - |
NML25_RS11050 (2289495) | 2289495..2290508 | + | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
NML25_RS11055 (2290509) | 2290509..2291450 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T251551 WP_000813795.1 NZ_CP101222:2285964-2286140 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT251551 WP_076797675.1 NZ_CP101222:2286186-2286602 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|