Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1851197..1851981 | Replicon | chromosome |
Accession | NZ_CP101222 | ||
Organism | Escherichia coli strain EC21Z-144 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | NML25_RS08670 | Protein ID | WP_000613626.1 |
Coordinates | 1851197..1851691 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | NML25_RS08675 | Protein ID | WP_001110447.1 |
Coordinates | 1851688..1851981 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML25_RS08650 (1846390) | 1846390..1847487 | + | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
NML25_RS08655 (1847487) | 1847487..1848428 | + | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
NML25_RS08660 (1848494) | 1848494..1850137 | + | 1644 | WP_000096478.1 | flagellar hook-associated protein FlgK | - |
NML25_RS08665 (1850149) | 1850149..1851102 | + | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
NML25_RS08670 (1851197) | 1851197..1851691 | - | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
NML25_RS08675 (1851688) | 1851688..1851981 | - | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
NML25_RS08680 (1852114) | 1852114..1855299 | - | 3186 | WP_001550951.1 | ribonuclease E | - |
NML25_RS08685 (1855872) | 1855872..1856831 | + | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T251549 WP_000613626.1 NZ_CP101222:c1851691-1851197 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|