Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 1595856..1596561 | Replicon | chromosome |
| Accession | NZ_CP101222 | ||
| Organism | Escherichia coli strain EC21Z-144 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | NML25_RS07460 | Protein ID | WP_000539521.1 |
| Coordinates | 1596175..1596561 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NML25_RS07455 | Protein ID | WP_001280945.1 |
| Coordinates | 1595856..1596185 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML25_RS07440 (1591013) | 1591013..1591924 | + | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
| NML25_RS07445 (1592102) | 1592102..1594450 | + | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
| NML25_RS07450 (1594458) | 1594458..1595786 | + | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
| NML25_RS07455 (1595856) | 1595856..1596185 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| NML25_RS07460 (1596175) | 1596175..1596561 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NML25_RS07465 (1596787) | 1596787..1598112 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| NML25_RS07470 (1598325) | 1598325..1598708 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| NML25_RS07475 (1598819) | 1598819..1599934 | + | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
| NML25_RS07480 (1599931) | 1599931..1600557 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T251548 WP_000539521.1 NZ_CP101222:c1596561-1596175 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|