Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 304545..305377 | Replicon | chromosome |
| Accession | NZ_CP101222 | ||
| Organism | Escherichia coli strain EC21Z-144 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | NML25_RS01390 | Protein ID | WP_000854753.1 |
| Coordinates | 304545..304919 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | NML25_RS01395 | Protein ID | WP_001540478.1 |
| Coordinates | 305009..305377 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML25_RS01370 (300898) | 300898..302436 | - | 1539 | WP_001187178.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| NML25_RS01375 (303185) | 303185..303754 | - | 570 | WP_001290252.1 | DUF4942 domain-containing protein | - |
| NML25_RS01380 (303851) | 303851..304048 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| NML25_RS01385 (304060) | 304060..304548 | - | 489 | WP_000777545.1 | DUF5983 family protein | - |
| NML25_RS01390 (304545) | 304545..304919 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| NML25_RS01395 (305009) | 305009..305377 | - | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NML25_RS01400 (305540) | 305540..305761 | - | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| NML25_RS01405 (305824) | 305824..306300 | - | 477 | WP_001186773.1 | RadC family protein | - |
| NML25_RS01410 (306316) | 306316..306801 | - | 486 | WP_001586019.1 | antirestriction protein | - |
| NML25_RS01415 (306893) | 306893..307711 | - | 819 | WP_023909075.1 | DUF932 domain-containing protein | - |
| NML25_RS01420 (307801) | 307801..308034 | - | 234 | WP_001278283.1 | DUF905 family protein | - |
| NML25_RS01425 (308040) | 308040..308717 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| NML25_RS01430 (308865) | 308865..309545 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 293409..318422 | 25013 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T251542 WP_000854753.1 NZ_CP101222:c304919-304545 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT251542 WP_001540478.1 NZ_CP101222:c305377-305009 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |