Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 8899..9491 Replicon plasmid pEC21Z147-62K-mcr1
Accession NZ_CP101213
Organism Escherichia coli strain EC21Z-147

Toxin (Protein)


Gene name hicA Uniprot ID A0A1I9ZJC5
Locus tag NML26_RS26870 Protein ID WP_000513532.1
Coordinates 8899..9147 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A1I9ZJ49
Locus tag NML26_RS26875 Protein ID WP_000681609.1
Coordinates 9144..9491 (+) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML26_RS26835 (NML26_26840) 3911..4576 - 666 WP_000532149.1 division plane positioning ATPase MipZ -
NML26_RS26840 (NML26_26845) 5165..5494 + 330 WP_001542022.1 hypothetical protein -
NML26_RS26845 (NML26_26850) 5895..6410 + 516 WP_001025393.1 J domain-containing protein -
NML26_RS26850 (NML26_26855) 6514..7056 + 543 WP_001083904.1 hypothetical protein -
NML26_RS26855 (NML26_26860) 7053..7307 + 255 WP_001230709.1 hypothetical protein -
NML26_RS26860 (NML26_26865) 7304..7546 + 243 WP_000151456.1 hypothetical protein -
NML26_RS26865 (NML26_26870) 8117..8410 + 294 WP_000673428.1 hypothetical protein -
NML26_RS26870 (NML26_26875) 8899..9147 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin Toxin
NML26_RS26875 (NML26_26880) 9144..9491 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NML26_RS26880 (NML26_26885) 9579..10022 - 444 WP_023223351.1 hypothetical protein -
NML26_RS26885 (NML26_26890) 10263..10562 + 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
NML26_RS26890 (NML26_26895) 10822..11148 - 327 WP_000206697.1 hypothetical protein -
NML26_RS26895 (NML26_26900) 11150..11473 - 324 WP_223666488.1 hypothetical protein -
NML26_RS26900 (NML26_26905) 11450..11590 - 141 Protein_20 hypothetical protein -
NML26_RS26905 (NML26_26910) 11610..12317 - 708 WP_000108794.1 hypothetical protein -
NML26_RS26910 (NML26_26915) 12319..13071 - 753 WP_000797966.1 conjugal transfer protein TraL -
NML26_RS26915 (NML26_26920) 13089..13490 - 402 WP_021575837.1 hypothetical protein -
NML26_RS26920 (NML26_26925) 13858..14199 + 342 WP_000730722.1 plasmid mobilization relaxosome protein MobC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62297 62297


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9378.03 Da        Isoelectric Point: 10.4800

>T251540 WP_000513532.1 NZ_CP101213:8899-9147 [Escherichia coli]
MGKADKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
VL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13206.97 Da        Isoelectric Point: 4.8313

>AT251540 WP_000681609.1 NZ_CP101213:9144-9491 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNILYGKLAFIRDLVTYEAETLADLEREFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSHHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I9ZJC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1I9ZJ49

References