251539

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 7053..7546 Replicon plasmid pEC21Z147-62K-mcr1
Accession NZ_CP101213
Organism Escherichia coli strain EC21Z-147

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag NML26_RS26855 Protein ID WP_001230709.1
Coordinates 7053..7307 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag NML26_RS26860 Protein ID WP_000151456.1
Coordinates 7304..7546 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML26_RS26810 (NML26_26815) 2083..2244 + 162 WP_001128311.1 hypothetical protein -
NML26_RS26815 (NML26_26820) 2570..2722 + 153 Protein_3 FlmC family protein -
NML26_RS26820 (NML26_26825) 2670..2789 + 120 WP_229002406.1 Hok/Gef family protein -
NML26_RS26825 (NML26_26830) 2939..3535 + 597 WP_000125165.1 ProQ/FINO family protein -
NML26_RS26830 (NML26_26835) 3553..3837 - 285 WP_001162371.1 hypothetical protein -
NML26_RS26835 (NML26_26840) 3911..4576 - 666 WP_000532149.1 division plane positioning ATPase MipZ -
NML26_RS26840 (NML26_26845) 5165..5494 + 330 WP_001542022.1 hypothetical protein -
NML26_RS26845 (NML26_26850) 5895..6410 + 516 WP_001025393.1 J domain-containing protein -
NML26_RS26850 (NML26_26855) 6514..7056 + 543 WP_001083904.1 hypothetical protein -
NML26_RS26855 (NML26_26860) 7053..7307 + 255 WP_001230709.1 hypothetical protein Toxin
NML26_RS26860 (NML26_26865) 7304..7546 + 243 WP_000151456.1 hypothetical protein Antitoxin
NML26_RS26865 (NML26_26870) 8117..8410 + 294 WP_000673428.1 hypothetical protein -
NML26_RS26870 (NML26_26875) 8899..9147 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin -
NML26_RS26875 (NML26_26880) 9144..9491 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin -
NML26_RS26880 (NML26_26885) 9579..10022 - 444 WP_023223351.1 hypothetical protein -
NML26_RS26885 (NML26_26890) 10263..10562 + 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
NML26_RS26890 (NML26_26895) 10822..11148 - 327 WP_000206697.1 hypothetical protein -
NML26_RS26895 (NML26_26900) 11150..11473 - 324 WP_223666488.1 hypothetical protein -
NML26_RS26900 (NML26_26905) 11450..11590 - 141 Protein_20 hypothetical protein -
NML26_RS26905 (NML26_26910) 11610..12317 - 708 WP_000108794.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62297 62297


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T251539 WP_001230709.1 NZ_CP101213:7053-7307 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT251539 WP_000151456.1 NZ_CP101213:7304-7546 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References