Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3867378..3868225 | Replicon | chromosome |
| Accession | NZ_CP101210 | ||
| Organism | Escherichia coli strain EC21Z-147 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NML26_RS18990 | Protein ID | WP_112044915.1 |
| Coordinates | 3867378..3867767 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NML26_RS18995 | Protein ID | WP_112044916.1 |
| Coordinates | 3867857..3868225 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML26_RS18960 (3862718) | 3862718..3863212 | + | 495 | WP_001059463.1 | MarR family transcriptional regulator | - |
| NML26_RS18965 (3863650) | 3863650..3863985 | - | 336 | Protein_3717 | Arm DNA-binding domain-containing protein | - |
| NML26_RS18970 (3864351) | 3864351..3865670 | + | 1320 | WP_000144688.1 | site-specific integrase | - |
| NML26_RS18975 (3865763) | 3865763..3866611 | - | 849 | WP_112044913.1 | DUF4942 domain-containing protein | - |
| NML26_RS18980 (3866696) | 3866696..3866893 | - | 198 | WP_000839267.1 | DUF957 domain-containing protein | - |
| NML26_RS18985 (3866905) | 3866905..3867393 | - | 489 | WP_112044914.1 | DUF5983 family protein | - |
| NML26_RS18990 (3867378) | 3867378..3867767 | - | 390 | WP_112044915.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NML26_RS18995 (3867857) | 3867857..3868225 | - | 369 | WP_112044916.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NML26_RS19000 (3868275) | 3868275..3868919 | - | 645 | WP_059252084.1 | hypothetical protein | - |
| NML26_RS19005 (3868934) | 3868934..3869155 | - | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| NML26_RS19010 (3869224) | 3869224..3869700 | - | 477 | WP_001186747.1 | RadC family protein | - |
| NML26_RS19015 (3869715) | 3869715..3870200 | - | 486 | WP_247855585.1 | antirestriction protein | - |
| NML26_RS19020 (3870291) | 3870291..3871109 | - | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE / vat / vat | 3821503..3883598 | 62095 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14459.57 Da Isoelectric Point: 8.7427
>T251524 WP_112044915.1 NZ_CP101210:c3867767-3867378 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKRCNWP
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKRCNWP
Download Length: 390 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13629.35 Da Isoelectric Point: 6.4768
>AT251524 WP_112044916.1 NZ_CP101210:c3868225-3867857 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNSRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNSRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|